Structure of PDB 6pwv Chain I Binding Site BS01

Receptor Information
>6pwv Chain I (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
Ligand information
>6pwv Chain O (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pwv Cryo-EM structure of the human MLL1 core complex bound to the nucleosome.
Resolution6.2 Å
Binding residue
(original residue number in PDB)
R29 R42 V43 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)
R18 R31 V32 G33 A34 K64 T65 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6pwv, PDBe:6pwv, PDBj:6pwv
PDBsum6pwv
PubMed31804488
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]