Structure of PDB 6pbs Chain I Binding Site BS01

Receptor Information
>6pbs Chain I (length=146) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYK
Ligand information
>6pbs Chain Q (length=12) Species: 1562372 (Nonomuraea sp. MJM5123) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVITTVLVVVFV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pbs Structure of the N-terminal domain of ClpC1 in complex with the antituberculosis natural product ecumicin reveals unique binding interactions.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q17 H77 F80 K85
Binding residue
(residue number reindexed from 1)		Q17 H77 F80 K85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6pbs, PDBe:6pbs, PDBj:6pbs
PDBsum6pbs
PubMed32355042
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]