Structure of PDB 6nue Chain I Binding Site BS01

Receptor Information
>6nue Chain I (length=295) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLESLKMGKLDAFLAE
ANQDKFTLTDAFPFQFGPFLPKPIGYPKHDQIDQSVDVKEVRRQAKLSKK
LQFLALENVDDYLNGELFENEEHAVIDTVTKNQPHKDGNLYQVATTRFSN
DTSLYVIANESDLLNELMSSLQYSGLGGKRSSGFGRFELDIQNIPLELSD
RLTKNHSDKVMSLTTALPVDADLEEAMEDGHYLLTKSSGFAFSHATNENY
RKQDLYKFASGSTFSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKL
Ligand information
>6nue Chain H (length=40) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacuuucguaacuguuuaauucuguucacuuauuc
........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nue Coupling of ssRNA cleavage with DNase activity in type III-A CRISPR-Csm revealed by cryo-EM and biochemistry.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		G16 S17 G18 R31 S34 A35 V37 L38 L41 L46 T132 K133 N134 P136 H137 Y143 G180 K181 R182 S183 S240 F242 F244 R253 K254 H284 A285 L287
Binding residue
(residue number reindexed from 1)		G14 S15 G16 R29 S32 A33 V35 L36 L39 L44 T130 K131 N132 P134 H135 Y141 G178 K179 R180 S181 S238 F240 F242 R251 K252 H282 A283 L285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6nue, PDBe:6nue, PDBj:6nue
PDBsum6nue
PubMed30814678
UniProtA0A0A7HGA1|CSM4_STRTR CRISPR system Cms protein Csm4 (Gene Name=csm4)

[Back to BioLiP]