Structure of PDB 6k4y Chain I Binding Site BS01

Receptor Information
>6k4y Chain I (length=88) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNIDTVREIITVASILIKFSREDIVENRANFIAFLNEIGVTHEGRKLNQN
SFRKIVSELTQEDKKTLIDEFNEGFEGVYRYLEMYTNK
Ligand information
>6k4y Chain N (length=59) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaaagaagctttgcttaataatccatatggttataatgggagctgtcac
ggatgcagg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k4y Structural basis of sigma appropriation.
Resolution3.79 Å
Binding residue
(original residue number in PDB)		R47 N50
Binding residue
(residue number reindexed from 1)		R45 N48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6k4y, PDBe:6k4y, PDBj:6k4y
PDBsum6k4y
PubMed31392983
UniProtP32267|ASIA_BPT4 10 kDa anti-sigma factor (Gene Name=asiA)

[Back to BioLiP]