Structure of PDB 6j6n Chain I Binding Site BS01

Receptor Information

>6j6n Chain I (length=102) Species: 559292 (Saccharomyces cerevisiae S288C)

RGGISYDQLAKLSYEKTLRNLATQTQNSSKQDKVQKDTKTGKITIADDDK
LVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSR
ES

Ligand information

>6j6n Chain E (length=103)

guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua

<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6j6n Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
• Resolution: 3.86 Å
• Binding residue (original residue number in PDB): Y97 S104 K107 R175 Y176 R179 K180
• Binding residue (residue number reindexed from 1): Y6 S13 K16 R66 Y67 R70 K71

Gene Ontology

Molecular Function

• GO:0000384 first spliceosomal transesterification activity
• GO:0000386 second spliceosomal transesterification activity
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071008 U2-type post-mRNA release spliceosomal complex

External links

• PDB: RCSB:6j6n, PDBe:6j6n, PDBj:6j6n
• PDBsum: 6j6n
• PubMed: 30879786
• UniProt: P53277|SYF2_YEAST Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)