Structure of PDB 6dc9 Chain I Binding Site BS01

Receptor Information
>6dc9 Chain I (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQQSGAELVQPGASVKLSCTASGFNIKDTSMHWVRQRPEQGLEWIGRIA
PANGNTKYDPKFQGKATITTDTSSNTAYLQLSSLTSEDTAVYYCSGSGNY
DWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK
PSNTKVDKRVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dc9 Structural characterization of monoclonal antibodies targeting C-terminal Ser404region of phosphorylated tau protein.
Resolution2.999 Å
Binding residue
(original residue number in PDB)		S33 H35 R50 S93 G94 S95 G96 W100
Binding residue
(residue number reindexed from 1)		S31 H33 R48 S95 G96 S97 G98 W102
External links