Structure of PDB 6db7 Chain I Binding Site BS01

Receptor Information
>6db7 Chain I (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKVSCEASGYTFAKFAIHWVRQAPRQGLEWMGW
INGDDGKTEYSQKFQDRVTMTRDTSASTVYMELSSLRSEDTALYYCARAM
YPDTVTGNDNPAPPPFEGDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTS
GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Ligand information
>6db7 Chain Q (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKRIHIGPGRAFY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6db7 Structural Comparison of Human Anti-HIV-1 gp120 V3 Monoclonal Antibodies of the Same Gene Usage Induced by Vaccination and Chronic Infection.
Resolution2.213 Å
Binding residue
(original residue number in PDB)		W50 N52 D53 D54 K56 Y97 P98 D99 P100G A100H P100I P100J
Binding residue
(residue number reindexed from 1)		W50 N52 D54 D55 K57 Y101 P102 D103 P111 A112 P113 P114
External links