Structure of PDB 6db5 Chain I Binding Site BS01

Receptor Information
>6db5 Chain I (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYAIHWVRQAPGHRLEWMGW
INGGDGNTKYSQKLQGRVTITRDTSASTAYMELSSLRSEDSAVYYCMRAY
YYGSRGLVDDALDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>6db5 Chain Q (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKGIAIGPGRTLYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6db5 Structural Comparison of Human Anti-HIV-1 gp120 V3 Monoclonal Antibodies of the Same Gene Usage Induced by Vaccination and Chronic Infection.
Resolution2.599 Å
Binding residue
(original residue number in PDB)		W50 N52 N56 Y97 G99 S100 G100B
Binding residue
(residue number reindexed from 1)		W50 N52 N57 Y101 G103 S104 G106
External links