Structure of PDB 6cqr Chain I Binding Site BS01

Receptor Information

>6cqr Chain I (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVM
TLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFKAAGNKLT
FGGGTRVLVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKD
SDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
S

Ligand information

>6cqr Chain H (length=13) Species: 11706 (HIV-1 M:B_HXB2R) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RFYKTLRAEQASQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6cqr CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
Resolution	3.04 Å
Binding residue (original residue number in PDB)	N29 F30 Y31 A105 G106 N107
Binding residue (residue number reindexed from 1)	N29 F30 Y31 A95 G96 N97

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002250	adaptive immune response
GO:0009617	response to bacterium

	Cellular Component
GO:0005886	plasma membrane
GO:0042101	T cell receptor complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6cqr, PDBe:6cqr, PDBj:6cqr
PDBsum	6cqr
PubMed	29884618
UniProt	A0A0B4J272\|TVA24_HUMAN T cell receptor alpha variable 24 (Gene Name=TRAV24)

[Back to BioLiP]