Structure of PDB 6b6h Chain I Binding Site BS01

Receptor Information
>6b6h Chain I (length=75) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKS
LTEIKDVLASRGLSLGMRLENWPPA
Ligand information
>6b6h Chain 1 (length=88) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
taaaatgtgatctagatcacattttaggcaaaaaaggccttgacatccca
cctcacgtatgctataatgtgtgcagtctgacgcggcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b6h Structural basis of bacterial transcription activation.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		V264 R265 N268 N294
Binding residue
(residue number reindexed from 1)		V15 R16 N19 N45
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6b6h, PDBe:6b6h, PDBj:6b6h
PDBsum6b6h
PubMed29146813
UniProtP0A7Z4|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]