Structure of PDB 5xtb Chain I Binding Site BS01

Receptor Information
>5xtb Chain I (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNY
YCTRDGRRESVPPSIIMSSQKTEKKAVTPAPPIKRWELSSDQPYL
Ligand information
>5xtb Chain W (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KQDMPPPGGYGPIDYKRNLPRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xtb Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		W14 H18 P39 K40 L41 P42
Binding residue
(residue number reindexed from 1)		W11 H15 P36 K37 L38 P39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0009060 aerobic respiration
GO:0042773 ATP synthesis coupled electron transport
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xtb, PDBe:5xtb, PDBj:5xtb
PDBsum5xtb
PubMed28844695
UniProtO95182|NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 (Gene Name=NDUFA7)

[Back to BioLiP]