Structure of PDB 5vk1 Chain I Binding Site BS01

Receptor Information
>5vk1 Chain I (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDAAAQHMVY
CGGDLLGELLGRQSFSVKDPSPLYDMLRKNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vk1 Dithiocarbamate-inspired side chain stapling chemistry for peptide drug design.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		V92 K93
Binding residue
(residue number reindexed from 1)		V67 K68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vk1, PDBe:5vk1, PDBj:5vk1
PDBsum5vk1
PubMed30809370
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]