Structure of PDB 5v6l Chain I Binding Site BS01

Receptor Information
>5v6l Chain I (length=218) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVESGGGLVKPGGTLTLTCTASGFSFSSGFFMCWVRQAPGKGLEWIGCI
YGGSNDNTYYANWAKGRFTISKTSSTTVTLQMTSRTAADTATYFCARDAG
TSGYIAYNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVK
GYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTC
NVAHPATNTKVDKTVAPS
Ligand information
>5v6l Chain Q (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HIGPGRAFYTTGEIIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v6l Increased epitope complexity correlated with antibody affinity maturation and a novel binding mode revealed by structures of rabbit antibodies against the third variable loop (V3) of HIV-1 gp120.
Resolution2.549 Å
Binding residue
(original residue number in PDB)		G32 F34 Y52 N54 Y58 D95 G97 S99 G100 Y100A I100B
Binding residue
(residue number reindexed from 1)		G30 F32 Y51 N55 Y59 D98 G100 S102 G103 Y104 I105
External links