Structure of PDB 5ui5 Chain I Binding Site BS01

Receptor Information

>5ui5 Chain I (length=316) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVE
ELEKVRQKVLRLEPLGVCSKDVWEFLELQIEEIYPEEEEILKKALRDLKR
GKKLKPEIKGKLSRLRLFPSAEKVYTFAKVDAIIEEENGEFFIYLYEDFI
DIDLNEEYWELYKNLQKELKEAFERYESIRKVLDIRRRNLRKVLEKIVER
QKDFLTGKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGTYSLRT
FFVRESAEGLTQGELMKLIKEIVERKPYSDQEIANILKEKGFKVARRTVA
KYREMLGIPSSRERRI

Ligand information

>5ui5 Chain A (length=31) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcgaaattggcacgaaaattgcaataaatag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ui5 Crystal structure of Aquifex aeolicus sigma (N) bound to promoter DNA and the structure of sigma (N)-holoenzyme.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	L294 R295 S309 R310 R327 S361 D362 R378 R379 R385 R394
Binding residue (residue number reindexed from 1)	L216 R217 S231 R232 R249 S279 D280 R296 R297 R303 R312
Binding affinity	PDBbind-CN: Kd=103nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001216	DNA-binding transcription activator activity
GO:0003677	DNA binding
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5ui5, PDBe:5ui5, PDBj:5ui5
PDBsum	5ui5
PubMed	28223493
UniProt	O66858

[Back to BioLiP]