Structure of PDB 5tez Chain I Binding Site BS01

Receptor Information

>5tez Chain I (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKRPQLIIDIRS
NVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAASFIIQGAQKL
VFGQGTRLTINPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
PS

Ligand information

>5tez Chain C (length=9) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GILGFVFTL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5tez Structural basis for clonal diversity of the human T-cell response to a dominant influenza virus epitope.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	I96 Q101
Binding residue (residue number reindexed from 1)	I93 Q98

External links

PDB	RCSB:5tez, PDBe:5tez, PDBj:5tez
PDBsum	5tez
PubMed	28931605

[Back to BioLiP]