Structure of PDB 5no6 Chain I Binding Site BS01

Receptor Information
>5no6 Chain I (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKT
RTRKQVSSHIQVLARRKARE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5no6 TEAD4-HOXB13 complex bound to DNA
Resolution2.88 Å
Binding residue
(original residue number in PDB)		K96 Q97 S100 R108
Binding residue
(residue number reindexed from 1)		K54 Q55 S58 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5no6, PDBe:5no6, PDBj:5no6
PDBsum5no6
PubMed
UniProtQ15561|TEAD4_HUMAN Transcriptional enhancer factor TEF-3 (Gene Name=TEAD4)

[Back to BioLiP]