Structure of PDB 5n99 Chain I Binding Site BS01

Receptor Information

>5n99 Chain I (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK

Ligand information

>5n99 Chain J (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NQPWQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5n99 Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	L25 S27 S45 W79 R84 A86 S88 T90 W108
Binding residue (residue number reindexed from 1)	L11 S13 S31 W65 R70 A72 S74 T76 W94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:5n99, PDBe:5n99, PDBj:5n99
PDBsum	5n99
PubMed	28935886
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]