Structure of PDB 5k36 Chain I Binding Site BS01

Receptor Information
>5k36 Chain I (length=224) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEA
ITATLVGTVRCEEEVKNILVSVLPGTEKGRKTNKYANNDFANNLPKEGDI
VLTRVTRLSLQRANVEILAVEDATFSVSSDLGETFRGIIRSQDVRSTDRD
RVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGL
MYATDWQMMTSPVTGATEKRKCAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k36 Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R145 Q149 R150
Binding residue
(residue number reindexed from 1)		R107 Q111 R112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0006401 RNA catabolic process
GO:0070481 nuclear-transcribed mRNA catabolic process, non-stop decay
GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
GO:0071038 TRAMP-dependent tRNA surveillance pathway
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5k36, PDBe:5k36, PDBj:5k36
PDBsum5k36
PubMed27818140
UniProtP53859|CSL4_YEAST Exosome complex component CSL4 (Gene Name=CSL4)

[Back to BioLiP]