Structure of PDB 5gm6 Chain I Binding Site BS01

Receptor Information
>5gm6 Chain I (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEQVR
SNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEK
SS
Ligand information
>5gm6 Chain D (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaggucaacaucaagaacugugggccuuugccuauagaacuuauaacga
acaugguucuugccuuuuaccagaaccauccggguguugucuccauccau
auuuuuuggaacuuuuc
<<<<<.<<<<<<<.....<<<<<<<<....>>>>>>>>............
..<<<<<<<<...........>>>>>>>>...>>>>>>>>>>>>......
.................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution3.5 Å
Binding residue
(original residue number in PDB)
M1 L4
Binding residue
(residue number reindexed from 1)
M1 L4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtQ07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)

[Back to BioLiP]