Structure of PDB 5e9d Chain I Binding Site BS01

Receptor Information
>5e9d Chain I (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVEQNSGPLSVPEGAIASLNCTYSDRGSTSFFWYRQYSGKSPELIMSIYS
NGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTKYSWGKLQFG
AGTQVVVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e9d An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
Resolution2.51 Å
Binding residue
(original residue number in PDB)		T30 Y93 S94
Binding residue
(residue number reindexed from 1)		T29 Y92 S93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e9d, PDBe:5e9d, PDBj:5e9d
PDBsum5e9d
PubMed27238970
UniProtA0A075B6T6|TVAL2_HUMAN T cell receptor alpha variable 12-2 (Gene Name=TRAV12-2)

[Back to BioLiP]