Structure of PDB 5dlm Chain I Binding Site BS01

Receptor Information
>5dlm Chain I (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQQSGGGSVKPGGSLKLSCSASGFSLSTYAMSWVRQTPEKRLEWVASM
SSGGSLYYPDTVKGRFTISRDTVKNIVYLQMSSLRSEDTAMYYCVRGGYG
TSYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dlm Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		A33 S52 S53 G54 Y58 G98 G99 G101 T102 S103
Binding residue
(residue number reindexed from 1)		A32 S51 S52 G53 Y57 G97 G98 G100 T101 S102
External links