Structure of PDB 5c0c Chain I Binding Site BS01

Receptor Information
>5c0c Chain I (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYS
SGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFG
SGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c0c Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
Resolution1.974 Å
Binding residue
(original residue number in PDB)		D94 S96 Y97
Binding residue
(residue number reindexed from 1)		D92 S94 Y95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5c0c, PDBe:5c0c, PDBj:5c0c
PDBsum5c0c
PubMed27183389
UniProtA0A0B4J271;
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]