Structure of PDB 5c0b Chain I Binding Site BS01

Receptor Information
>5c0b Chain I (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYS
SGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFG
SGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c0b Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
Resolution2.03 Å
Binding residue
(original residue number in PDB)
D94 Y97
Binding residue
(residue number reindexed from 1)
D92 Y95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5c0b, PDBe:5c0b, PDBj:5c0b
PDBsum5c0b
PubMed27183389
UniProtA0A0B4J271;
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]