Structure of PDB 5bkl Chain I Binding Site BS01

Receptor Information

>5bkl Chain I (length=144) Species: 12881 (Satellite tobacco mosaic virus)

NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF
RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN
INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Ligand information

>5bkl Chain a (length=5)

aaaaa

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5bkl Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts.
• Resolution: 2.94 Å
• Binding residue (original residue number in PDB): N16 S17
• Binding residue (residue number reindexed from 1): N1 S2

Gene Ontology

Molecular Function

• GO:0005198 structural molecule activity

Cellular Component

• GO:0019028 viral capsid

External links

• PDB: RCSB:5bkl, PDBe:5bkl, PDBj:5bkl
• PDBsum: 5bkl
• PubMed: 34866603
• UniProt: P17574|COAT_STMV Coat protein