Structure of PDB 5ajk Chain I Binding Site BS01

Receptor Information
>5ajk Chain I (length=137) Species: 10255 (Variola virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLPTKTRSYIDIINMYCDK
VNNDYNRDMNIMYDMASTESFTVYDINNEVNTILMDNKGLGVRLATISFI
TELGKRCMNPVETIKMFTLLSHTICDDCFIDYITDIS
Ligand information
>5ajk Chain J (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSTMGQVGRQLAIIGDDINRRYDS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ajk Variola Virus F1L is a Bcl-2-Like Protein that Unlike its Vaccinia Virus Counterpart Inhibits Apoptosis Independent of Bim.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
K114 D118 Y119 M126 M129 E133 D139 I140 E143 I147 G155 V156 A159 F163
Binding residue
(residue number reindexed from 1)
K50 D54 Y55 M62 M65 E69 D75 I76 E79 I83 G91 V92 A95 F99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5ajk, PDBe:5ajk, PDBj:5ajk
PDBsum5ajk
PubMed25766319
UniProtQ85365|PG045_VARV Apoptosis regulator OPG045 (Gene Name=OPG045)

[Back to BioLiP]