Structure of PDB 4zto Chain I Binding Site BS01

Receptor Information
>4zto Chain I (length=221) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSLEESGGGPVKPGGTLTLTCKASGIDFSSFYYMCWVRQAPGKGLEWIAC
IVTDITGESYYATWAKGRFAISKTSSTTVTLQMTSLTAADTATYFCARGD
TYGYGDTVYALNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLG
CLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQ
PVTCNVAHPATNTKVDKTVAP
Ligand information
>4zto Chain Q (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKAMYAPPIR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zto Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F31 D51B E55 Y97 G98 Y99
Binding residue
(residue number reindexed from 1)		F31 D54 E58 Y102 G103 Y104
External links