Structure of PDB 4z88 Chain I Binding Site BS01

Receptor Information
>4z88 Chain I (length=66) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGEL
RGRRGYVPHNMVSEVE
Ligand information
>4z88 Chain U (length=12) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRKLPEIPKNKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		F1324 D1325 Y1326 N1334 D1336 D1359 F1361 Y1372 P1374 H1375
Binding residue
(residue number reindexed from 1)		F8 D9 Y10 N18 D20 D43 F45 Y56 P58 H59
Enzymatic activity
Enzyme Commision number ?
External links