Structure of PDB 4xrs Chain I Binding Site BS01

Receptor Information
>4xrs Chain I (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNR
RSKFKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xrs DNA-dependent formation of transcription factor pairs alters their binding specificity.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R133 K174 R181
Binding residue
(residue number reindexed from 1)		R3 K44 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xrs, PDBe:4xrs, PDBj:4xrs
PDBsum4xrs
PubMed26550823
UniProtO60479|DLX3_HUMAN Homeobox protein DLX-3 (Gene Name=DLX3)

[Back to BioLiP]