Structure of PDB 4xmk Chain I Binding Site BS01

Receptor Information
>4xmk Chain I (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVGSGGGLIQPGGSLRLSCAASDFSVSEYYMTWVRQAPGKGLEWVAV
LYKDGSQFYAPSVKGRFIVSRDNSKNSLYLQMNNLRGEDTAVYFCARENA
DYGSDYYFGMDVWGQGTAVAVSSASTKGPSVFPLAPSGTAALGCLVKDYF
PEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEP
Ligand information
>4xmk Chain Q (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IHIGPGRAFYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xmk Functional and Structural Characterization of Human V3-Specific Monoclonal Antibody 2424 with Neutralizing Activity against HIV-1 JRFL.
Resolution3.179 Å
Binding residue
(original residue number in PDB)		Y33 Y52 D54 Y99 G100 D100B
Binding residue
(residue number reindexed from 1)		Y33 Y52 D54 Y102 G103 D105
External links