Structure of PDB 4qyz Chain I Binding Site BS01

Receptor Information
>4qyz Chain I (length=256) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSNFINIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRK
SGYYAQNIGEQGVDIALSGRMDGAMSIAHAITTHQVDSDIDWFTAVDDLQ
EQGSAHLGTQEFSSGVFYRYANINLAQLQENLGGASREQALEIATHVVHM
LATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKAKDGFLQP
SIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQLKSWV
RNNGEA
Ligand information
>4qyz Chain L (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auaaaccgccagugauaaguggaaugccaugugggcugucgaguucccgg
ccggg
.............................................<<<<.
.>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qyz Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
Resolution3.0303 Å
Binding residue
(original residue number in PDB)
N19 R20 D21 D22 K27 Q42 S43 K45 R46 R49 R165 D179 F200 T201 V203 A265 K266
Binding residue
(residue number reindexed from 1)
N19 R20 D21 D22 K27 Q42 S43 K45 R46 R49 R70 D72 F93 T94 V96 A158 K159
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0071667 DNA/RNA hybrid binding
Biological Process
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4qyz, PDBe:4qyz, PDBj:4qyz
PDBsum4qyz
PubMed25123481
UniProtQ46899|CASC_ECOLI CRISPR system Cascade subunit CasC (Gene Name=casC)

[Back to BioLiP]