Structure of PDB 4n8c Chain I Binding Site BS01

Receptor Information
>4n8c Chain I (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGPEVVRPGVSVRISCKGSGYTFTDYAMHWVKQSHAKSLDWIGV
IGTDNGNTNYNQKFKGKATMTVDKSSNTAYMELGRLTSEDSAIYYCARRD
RDDVWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKG
YFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSIT
CNVAHPASSTKVDKKIEPRGP
Ligand information
>4n8c Chain Y (length=14) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLTEVETPIRNEWG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n8c Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
Resolution1.6 Å
Binding residue
(original residue number in PDB)		A33 H35 G52 N57 T58 N59 R99 R101 D102 D103 V104
Binding residue
(residue number reindexed from 1)		A33 H35 G52 N57 T58 N59 R99 R101 D102 D103 V104
External links