Structure of PDB 4jo3 Chain I Binding Site BS01

Receptor Information
>4jo3 Chain I (length=227) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSLEESGGDLVKPGASLTLTCTASGFSFTNNYYMCWVRQAPGKGLEWIAC
IYGGGRDIVFYATWAKGRFTISKTSSTTVTLQMTSLTAADTATYFCAREN
FDAVGVGGGTYSTDYYFDLWGPGTLVIVSSGQPKAPSVFPLAPCCGDTPS
ATVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVS
VTSSSQPVTCNVAHPATNTKVDKTVAP
Ligand information
>4jo3 Chain Q (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIIGDIRQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jo3 Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y52 R54 I56 F58 T100F Y100G S100H Y100K
Binding residue
(residue number reindexed from 1)		Y52 R56 I58 F60 T110 Y111 S112 Y115
External links