Structure of PDB 4cc7 Chain I Binding Site BS01

Receptor Information
>4cc7 Chain I (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKG
YVPSNYIRKTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cc7 Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		Y1522 E1531 D1547 V1548 T1549 W1554 Y1565 N1569 Y1570
Binding residue
(residue number reindexed from 1)		Y8 E17 D33 V34 T35 W40 Y51 N55 Y56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cc7, PDBe:4cc7, PDBj:4cc7
PDBsum4cc7
PubMed24332715
UniProtQ6XZF7|DNMBP_HUMAN Dynamin-binding protein (Gene Name=DNMBP)

[Back to BioLiP]