Structure of PDB 4aso Chain I Binding Site BS01

Receptor Information
>4aso Chain I (length=93) Species: 1428 (Bacillus thuringiensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKP
TVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aso Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems.
Resolution7.0 Å
Binding residue
(original residue number in PDB)
N42 K43 T44 K54 P55 F58
Binding residue
(residue number reindexed from 1)
N37 K38 T39 K49 P50 F53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0042802 identical protein binding
Biological Process
GO:0030541 plasmid partitioning

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4aso, PDBe:4aso, PDBj:4aso
PDBsum4aso
PubMed23010931
UniProtQ8KNP2|TUBR_BACTI DNA-binding transcriptional repressor TubR (Gene Name=tubR)

[Back to BioLiP]