Structure of PDB 3utt Chain I Binding Site BS01

Receptor Information

>3utt Chain I (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYS
SGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFG
SGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS

Ligand information

>3utt Chain H (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ALWGPDPAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3utt Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	D94 S95 Y97
Binding residue (residue number reindexed from 1)	D92 S93 Y95

External links

PDB	RCSB:3utt, PDBe:3utt, PDBj:3utt
PDBsum	3utt
PubMed	22245737

[Back to BioLiP]