Structure of PDB 3t5q Chain I Binding Site BS01

Receptor Information
>3t5q Chain I (length=302) Species: 300180 (Mopeia Lassa virus reassortant 29) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKE
RRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLE
KLKSKVNLSSQQLDQRRALLNMIGRVWDVKNAELLSNQFGTMPSLTLACL
TKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKS
SLNISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSILKVKK
ALGMFISDTPGERNPYENILYKICLSGDGWPYIASRTSITGRAWENTVVD
LE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3t5q Crystal structure of the Lassa virus nucleoprotein-RNA complex reveals a gating mechanism for RNA binding.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S9 V113 W164 N174 F176 G177 T178 Y213 N215 T216 S237 S238 L239 N240 S247 L248 G249 K253 R300 Y308 K309 R323 R329
Binding residue
(residue number reindexed from 1)		S2 V106 W127 N137 F139 G140 T141 Y176 N178 T179 S200 S201 L202 N203 S210 L211 G212 K216 R263 Y271 K272 R286 R292
Enzymatic activity
Enzyme Commision number 3.1.13.-
External links