Structure of PDB 3pqy Chain I Binding Site BS01

Receptor Information
>3pqy Chain I (length=188) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTTQPDSMESTEGETVHLPCSHATISGNEYIYWYRQVPLQGPEYVTHGLQ
QNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILSGGSNYKLTFGK
GTLLTVTPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNDVYITDKCVL
DMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pqy Structural basis for enabling T-cell receptor diversity within biased virus-specific CD8+ T-cell responses
Resolution3.192 Å
Binding residue
(original residue number in PDB)
S107 G108 G109 S110 N111 Y112
Binding residue
(residue number reindexed from 1)
S89 G90 G91 S92 N93 Y94
Enzymatic activity
Enzyme Commision number ?
External links