Structure of PDB 3mls Chain I Binding Site BS01

Receptor Information

>3mls Chain I (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGI
IYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLY
LFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKS

Ligand information

>3mls Chain Q (length=20) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ACQAFYASSPRKSIHIGACA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3mls Conserved structural elements in the V3 crown of HIV-1 gp120.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	D31 W33 Y52 D54 D56 H58 L97 S100C N100E
Binding residue (residue number reindexed from 1)	D31 W33 Y52 D55 D57 H59 L101 S107 N109

External links

PDB	RCSB:3mls, PDBe:3mls, PDBj:3mls
PDBsum	3mls
PubMed	20622876

[Back to BioLiP]