Structure of PDB 3gd1 Chain I Binding Site BS01

Receptor Information

>3gd1 Chain I (length=358) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVI
IDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAH
TMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQ
IINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFA
QFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFF
PPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGET
IFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMA
VRNNLAGA

Ligand information

>3gd1 Chain Z (length=8) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TNLIELDA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3gd1 Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Resolution	3.5 Å
Binding residue (original residue number in PDB)	R64 P65 I66 S67 L82 A84 Q89 F91 K96 K98
Binding residue (residue number reindexed from 1)	R62 P63 I64 S65 L80 A82 Q87 F89 K94 K96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Biological Process
GO:0006886	intracellular protein transport
GO:0016192	vesicle-mediated transport

	Cellular Component
GO:0030130	clathrin coat of trans-Golgi network vesicle
GO:0030132	clathrin coat of coated pit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3gd1, PDBe:3gd1, PDBj:3gd1
PDBsum	3gd1
PubMed	19710023
UniProt	P49951\|CLH1_BOVIN Clathrin heavy chain 1 (Gene Name=CLTC)

[Back to BioLiP]