Structure of PDB 3cii Chain I Binding Site BS01

Receptor Information
>3cii Chain I (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFM
SSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPN
GNALDESCEDKNRYICKQQLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cii Structural basis for NKG2A/CD94 recognition of HLA-E.
Resolution4.41 Å
Binding residue
(original residue number in PDB)
Q112 N156 N160
Binding residue
(residue number reindexed from 1)
Q54 N98 N102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3cii, PDBe:3cii, PDBj:3cii
PDBsum3cii
PubMed18448674
UniProtQ13241|KLRD1_HUMAN Natural killer cells antigen CD94 (Gene Name=KLRD1)

[Back to BioLiP]