Structure of PDB 3c2a Chain I Binding Site BS01

Receptor Information
>3c2a Chain I (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLRLTCVASGFTFSDVWLNWVRQAPGKGLEWVGR
IKSRTDGGTTDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYSCTT
DGFIMIRGVSEDYYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPCSRSTS
GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
TVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL
Ligand information
>3c2a Chain Q (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIHLGPGRAFYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c2a Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
Resolution2.1 Å
Binding residue
(original residue number in PDB)		W33 R50 K52 D95 S100D D100F Y100G Y100H Y100J
Binding residue
(residue number reindexed from 1)		W33 R50 K52 D101 S110 D112 Y113 Y114 Y116
External links