Structure of PDB 2zpk Chain I Binding Site BS01

Receptor Information
>2zpk Chain I (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPEVQKPGETVRISCKASGYTFTTAGMQWVQKMPGKSLKWIGW
INTRSGVPKYAEDFKGRFAFSLETSASIAYLHINNLKNEDTATYFCAREG
PGFVYWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASST
KVDKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zpk Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification
Resolution1.8 Å
Binding residue
(original residue number in PDB)		T30 A32 G33 W50 N52 T52A E95 G96 P97
Binding residue
(residue number reindexed from 1)		T30 A32 G33 W50 N52 T53 E99 G100 P101
External links