Structure of PDB 2wwb Chain I Binding Site BS01

Receptor Information

>2wwb Chain I (length=153) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQ
VLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAA
NAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVV
TEK

Ligand information

>2wwb Chain E (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugaaaagaacuuugaaaagagagugaaaaaguac

.........<<<<....>>>>.............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2wwb Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
Resolution	6.48 Å
Binding residue (original residue number in PDB)	M1 R3 R18 S20 N101
Binding residue (residue number reindexed from 1)	M1 R3 R18 S20 N101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2wwb, PDBe:2wwb, PDBj:2wwb
PDBsum	2wwb
PubMed	19933108
UniProt	P05740\|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)

[Back to BioLiP]