Structure of PDB 1xgy Chain I Binding Site BS01

Receptor Information

>1xgy Chain I (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLQQSGPELVRPGASVKISCKASGYTFTDYYINWVKQRPGQGLEWIGW
IFPRNGNTKYNEKFKGKATLTVDKSSSTAFMQLSSLTSEDSAVYFCATTV
SYVMDYWGQGTTVTVSSAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPRD

Ligand information

>1xgy Chain Q (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TGALQE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1xgy Equilibrium between metarhodopsin-I and metarhodopsin-II is dependent on the conformation of the third cytoplasmic loop.
Resolution	2.71 Å
Binding residue (original residue number in PDB)	Y33 N35 W50 T95 Y98 V99
Binding residue (residue number reindexed from 1)	Y33 N35 W50 T99 Y102 V103

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1xgy, PDBe:1xgy, PDBj:1xgy
PDBsum	1xgy
PubMed	16407202
UniProt	Q6PF95

[Back to BioLiP]