Structure of PDB 1tzg Chain I Binding Site BS01

Receptor Information
>1tzg Chain I (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGG
VIPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREG
TTGWGWLGKPIGAFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tzg Broadly Neutralizing Anti-HIV Antibody 4E10 Recognizes a Helical Conformation of a Highly Conserved Fusion-Associated Motif in gp41
Resolution2.2 Å
Binding residue
(original residue number in PDB)		T31 G50 V51 I52 I56 N58 E95 P100F
Binding residue
(residue number reindexed from 1)		T31 G50 V51 I52 I57 N59 E99 P110
External links