Structure of PDB 1ngm Chain I Binding Site BS01

Receptor Information
>1ngm Chain I (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ngm Crystal structure of a transcription factor IIIB core interface ternary complex
Resolution2.95 Å
Binding residue
(original residue number in PDB)		V71 T73 F116 K120 V122 Q158 N159 L189 F190 R196 V203 L205 T215
Binding residue
(residue number reindexed from 1)		V11 T13 F56 K60 V62 Q98 N99 L129 F130 R136 V143 L145 T155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ngm, PDBe:1ngm, PDBj:1ngm
PDBsum1ngm
PubMed12660736
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]