Structure of PDB 1mjq Chain I Binding Site BS01

Receptor Information
>1mjq Chain I (length=104) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRH
ATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPE
TWEY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mjq Direct and indirect readout in mutant Met repressor-operator complexes.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		G15 K17 K23 R40 T52 N53 S54
Binding residue
(residue number reindexed from 1)		G15 K17 K23 R40 T52 N53 S54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006555 methionine metabolic process
GO:0009086 methionine biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mjq, PDBe:1mjq, PDBj:1mjq
PDBsum1mjq
PubMed10986458
UniProtP0A8U6|METJ_ECOLI Met repressor (Gene Name=metJ)

[Back to BioLiP]