Structure of PDB 1knz Chain I Binding Site BS01

Receptor Information
>1knz Chain I (length=154) Species: 10923 (Simian rotavirus A/SA11) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDD
SGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRM
MLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFV
DEKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1knz Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		N62 G65 K66 T69 S80 R83 N84 W87 D100 G131 K132 S133 S134 S135
Binding residue
(residue number reindexed from 1)		N56 G59 K60 T63 S74 R77 N78 W81 D94 G122 K123 S124 S125 S126
Binding affinityPDBbind-CN: Kd=79nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1knz, PDBe:1knz, PDBj:1knz
PDBsum1knz
PubMed11792322
UniProtP03536|NSP3_ROTS1 Non-structural protein 3

[Back to BioLiP]