Structure of PDB 1jvq Chain I Binding Site BS01

Receptor Information
>1jvq Chain I (length=410) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDICTAKPRDIPMNPMCIYRSPEEATNRRVWELSKANSRFATTFYQHLAD
SKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQ
IHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGA
KLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNT
IYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAEGTQ
VLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVV
HMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAF
HKAFLEVNEEGSASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTII
FMGRVANPCV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jvq How small peptides block and reverse serpin polymerisation
Resolution2.6 Å
Binding residue
(original residue number in PDB)
S82 I83 V190 R197 I198 V216 N217 T218 I219 Y220 F221 K222 G223 W225 F274 F368 H369 K370 A371 F372 L373 E374 V375 N376 F422
Binding residue
(residue number reindexed from 1)
S64 I65 V172 R179 I180 V198 N199 T200 I201 Y202 F203 K204 G205 W207 F256 F350 H351 K352 A353 F354 L355 E356 V357 N358 F401
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005515 protein binding
GO:0008201 heparin binding
GO:0042802 identical protein binding
Biological Process
GO:0007596 blood coagulation
GO:0010466 negative regulation of peptidase activity
GO:0030193 regulation of blood coagulation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005788 endoplasmic reticulum lumen
GO:0005886 plasma membrane
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0072562 blood microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1jvq, PDBe:1jvq, PDBj:1jvq
PDBsum1jvq
PubMed15342247
UniProtP01008|ANT3_HUMAN Antithrombin-III (Gene Name=SERPINC1)

[Back to BioLiP]