Structure of PDB 1f2i Chain I Binding Site BS01

Receptor Information
>1f2i Chain I (length=66) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMR
NFSRSDHLTTHIRTHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f2i Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R3103 R3114 F3116 R3118 E3121 R3124 H3125 I3128 S3145 R3146 H3149
Binding residue
(residue number reindexed from 1)		R11 R22 F24 R26 E29 R32 H33 I36 S53 R54 H57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1f2i, PDBe:1f2i, PDBj:1f2i
PDBsum1f2i
PubMed11427887
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]